PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g23750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ARF
Protein Properties Length: 1108aa    MW: 121850 Da    PI: 6.7966
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g23750genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.55.2e-23127228199
                EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F +  + +++l++
  Tp6g23750 127 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIR--DGKAQLLL 223
                99*****************************98888885.9************************************************5..46788899 PP

                EEE-S CS
         B3  95 kvfrk 99 
                +++r+
  Tp6g23750 224 GIRRA 228
                99997 PP

2Auxin_resp117.61.1e-38253335183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aaha +++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g+sdldpvrW+nS+Wr+L+
   Tp6g23750 253 AAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQ 335
                 799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-42117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-41121242IPR015300DNA-binding pseudobarrel domain
CDDcd100179.89E-20126227No hitNo description
PROSITE profilePS5086312.125127229IPR003340B3 DNA binding domain
SMARTSM010199.7E-23127229IPR003340B3 DNA binding domain
PfamPF023622.9E-21127228IPR003340B3 DNA binding domain
PfamPF065079.5E-34253335IPR010525Auxin response factor
PfamPF023091.4E-99791067IPR033389AUX/IAA domain
PROSITE profilePS5174526.9569811074IPR000270PB1 domain
SuperFamilySSF542777.36E-99931059No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1108 aa     Download sequence    Send to blast
MKAPSSNGVS PNPVEGERRN INSELWHACA GPLISLPPAG SLVVYFPQGH SEQVAASMQK  60
QTDFIPSYPN LPSKLICMLH NVTLNADPET DEVYAQMTLQ PVNKYDRDAL LASDMGLKLN  120
RQPNEFFCKT LTASDTSTHG GFSVPRRAAE KIFPALDFSM QPPCQELVAK DIHDNTWTFR  180
HIYRGQPKRH LLTTGWSVFV STKRLFAGDS VLFIRDGKAQ LLLGIRRANR QQPALSSSVI  240
SSDSMHIGVL AAAAHANANN SPFTIFYNPR AAPAEFVVPL AKYTKAMYAQ VSLGMRFRMI  300
FETEECGVRR YMGTVTGISD LDPVRWKNSQ WRNLQIGWDE SAAGDRPSRV SVWDIEPVLT  360
PFYICPPPFF RPRFAGQPGM PDDETDMESA LKRAMPWLDN SLEMKDPSST IFPGLSLVQW  420
MNMQQQNGQL PSAGAQPGFF PSMLSPAAGL HNNLGGTDDP SKLLSFQTPP GGISSSNLQF  480
NKPNQQASHL PQPPTTLSQQ QQLQQLLHSS LNHQQQQSQT QPLQSHSHPQ PQPQQLQPHK  540
LQQFQLPQNQ LYNGQQTAQQ LQAQQASMHH LQPQVVSGSM ANSVIAPPSS SHNQSFQQST  600
QLQHTHRHIG ASASQSSVIE TSKPSSNLMS IPLQDTQFPR QVEQQQPPGL VKGHNQQTLV  660
QQKAQQAQVQ QIFQQSLLEQ PHLQFQLLQR LQQQQQQQQQ QQQFLSPGSS SLQSQLLHQQ  720
LQSQQLQQAP SLSQGQQFPS SCTNTGLSTL QPPQMLVSRP QDKQNPPVGG GVKAYSGITD  780
GGDAPSSSTS PSTNNCQISS SSFLNRSQSG PAILIPDAAV DMSGSLVQDL YSKSDMRLKH  840
ELVGQQKSKP GLTDHQLEAS ASGTSYGLDG GENNRQQNFL SPNFGLDGDS RNSLLGGANV  900
DNGFVPDTLL SRGYDSQKDL QNMLSNYGGV TNDIGTEMST SAVRTQSFGI PNVPAISNDV  960
AVNDAGVLGG GSWPTQTQRM RTYTKVQKRG SVGRSIDVNR YRGYDELRHD LARMFGIEGQ  1020
LEDPQTSDWK LVYVDHENDI LLVGDDPWEE FVNCVQSIKI LSSAEVQQMS LDGNFAGLPV  1080
TNQAFSGGDS GNAWRGHYDD NSATSFNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1682135651388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0421950.0AF042195.1 Arabidopsis thaliana auxin response factor 7 (ARF7) mRNA, complete cds.
GenBankAY6697890.0AY669789.1 Arabidopsis thaliana clone C105344 ARF7 (At5g20730) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093873.10.0PREDICTED: auxin response factor 19
TrEMBLA0A078DU450.0A0A078DU45_BRANA; Auxin response factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein